PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g014200.1
Common NameMTR_2g014200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 144aa    MW: 16784.4 Da    PI: 6.9347
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g014200.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1322.1e-4164140278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      Cqv++C+adls ak+yh+rhkvCe hska +vl+s+l+qrfCqqCsrfhe+sefD+ krsCrrrLa+hnerrrk+++
  Medtr2g014200.1  64 CQVDNCNADLSAAKQYHKRHKVCENHSKAHSVLISELQQRFCQQCSRFHEVSEFDDLKRSCRRRLAGHNERRRKSAS 140
                      **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375759.4E-616143IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.4E-3357125IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.44561138IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-3662141IPR004333Transcription factor, SBP-box
PfamPF031104.9E-3264137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MDGSWGEGKR IYEYREENEY EVEVEIEEEE DVSYGDDEKR KRVVTDHLYN KKGSKAGGSV  60
TPSCQVDNCN ADLSAAKQYH KRHKVCENHS KAHSVLISEL QQRFCQQCSR FHEVSEFDDL  120
KRSCRRRLAG HNERRRKSAS EYH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3556137384squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.212850.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1463370.0BT146337.1 Medicago truncatula clone JCVI-FLMt-8A17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003593617.11e-102squamosa promoter-binding-like protein
SwissprotQ387418e-49SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLG7ISD51e-102G7ISD5_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA13G31090.12e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-39squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Aung B, et al.
    MicroRNA156 as a promising tool for alfalfa improvement.
    Plant Biotechnol. J., 2015. 13(6): p. 779-90
    [PMID:25532560]